HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0FKN6",
"id": "VMPA_LOXIN",
"source_organism": {
"taxId": "58218",
"scientificName": "Loxosceles intermedia",
"fullName": "Loxosceles intermedia (Brown spider)"
},
"name": "Astacin-like metalloprotease toxin 1",
"description": [
"Zinc metalloprotease. Provoques deadhesion of endothelial cells from cell cultures, and also degradation of fibronectin, fibrinogen and gelatin in vitro. Its role in the venom is not fully understood but it might act as a spreading factor that facilitates diffusion of other venom toxins. Alternatively, it might be involved in the proteolytic processing of other venom toxins or it might play a role in extra-oral digestion of prey"
],
"length": 264,
"sequence": "MIKYIGVFAFLVGGFCHDFETVISNQDPIVDGMRLVEGDMLFDDGPLFTERNAVKYDQQLWPNGEIVYEISPGLRQYEQIIREAMRTYEDNTCIKFRRRTNEADYVNIHVGDRCYSRVGKSFRGGPQPLSLGRGCTDFGTILHELGHSVGFDHEHSRADRDEFLIIHKENIKNGSEHNFDKLWENNTRTIGPFDYDSIMLYGAYAFSKDTRKFKTMEPVEPGLPMKSVIQKGKLSYYDIVKVNKLYKCPPVNPYPGGIRPYVNV",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0008237",
"name": "metallopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004222",
"name": "metalloendopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "efeb0259b28ed197c93a8972de3a29c21620a393",
"counters": {
"domain_architectures": 19101,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 19101
}
}
}