General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0BH22",
        "id": "A0BH22_PARTE",
        "source_organism": {
            "taxId": "5888",
            "scientificName": "Paramecium tetraurelia",
            "fullName": "Paramecium tetraurelia"
        },
        "name": "Cyclin-dependent kinases regulatory subunit",
        "description": [
            "Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function"
        ],
        "length": 101,
        "sequence": "MEQNLDEKMYAIDQKQKDKFPLTNQISQDFEDDTHIYRIIRLGRESVRLMQEFKWEKKLLKEEEWRRLRVYQRRGWLHYAIFEKEPYVLLFKRKITKNKRS",
        "proteome": "UP000000600",
        "gene": "GSPATT00028874001",
        "go_terms": [
            {
                "identifier": "GO:0016538",
                "name": "cyclin-dependent protein serine/threonine kinase regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "573de365b1a9b08c6bf1cae7df2ff815ab46e983",
        "counters": {
            "domain_architectures": 5923,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5923
        }
    }
}