HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AB73A8N5",
"id": "A0AB73A8N5_ENTFC",
"source_organism": {
"taxId": "1244154",
"scientificName": "Enterococcus faecium SD2A-2",
"fullName": "Enterococcus faecium SD2A-2"
},
"name": "Carbamoyl phosphate synthase small chain",
"description": [
"Small subunit of the glutamine-dependent carbamoyl phosphate synthetase (CPSase). CPSase catalyzes the formation of carbamoyl phosphate from the ammonia moiety of glutamine, carbonate, and phosphate donated by ATP, constituting the first step of 2 biosynthetic pathways, one leading to arginine and/or urea and the other to pyrimidine nucleotides. The small subunit (glutamine amidotransferase) binds and cleaves glutamine to supply the large subunit with the substrate ammonia"
],
"length": 358,
"sequence": "MERLLILEDGTVFEGKAFGADANVFGEIVFTTSMTGYQETITDQSFNGQIITFTYPMVGNYGVNRDDYESISPTCKGVVVKEHARVASNWRNQMTLDSFLKQKGIPGISGIDTRALTRKIREAGTMKASIVDAGDSFEHAFDQLKATVLATNQVQQVSTNKPYPSPGTGRKVIVIDFGLKHSILRELSKRNCNLTVLPYNTDAETILALSPDGVMLTNGPGDPKDVPEAIEMIKKIQGKVPIFGICLGHQLFALANGADTYKMKFGHRGLNHPVREVATGRIDFTSQNHGYAVDEATIDPEKLIVTHVEVNDGTVEGVKHRDYPAFSVQFHPDAAPGPHDALHLFDEFMEMMDAGKEQ",
"proteome": null,
"gene": "carA",
"go_terms": [
{
"identifier": "GO:0004088",
"name": "carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006207",
"name": "'de novo' pyrimidine nucleobase biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006541",
"name": "glutamine metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ca8d55c21f73d160cbeb47ce92e2ac93ab15d9c4",
"counters": {
"domain_architectures": 31871,
"entries": 23,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"profile": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"prints": 3,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 31871
}
}
}