General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB40A0N2",
        "id": "A0AB40A0N2_DROSZ",
        "source_organism": {
            "taxId": "28584",
            "scientificName": "Drosophila suzukii",
            "fullName": "Drosophila suzukii (Spotted-wing drosophila fruit fly)"
        },
        "name": "Peroxisome assembly protein 12",
        "description": [
            "Component of a retrotranslocation channel required for peroxisome organization by mediating export of the PEX5 receptor from peroxisomes to the cytosol, thereby promoting PEX5 recycling"
        ],
        "length": 297,
        "sequence": "MAEAANVRQNLQNVPSIFEISAAETLDNLIYPALSKIFDYFGLRLDFKLWGNLRIKEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTATETGDLLNRRQQFASATLLTFVPYVERKLRSRIARHEDTNPWEQRLLSTFHAFHAAKAVHTFLYLVKYASNHSPIFRALGLTLRYPSEPPKEDQWTYLVLKMLEVLAFFLQFVQWWYSNDQRRKVGGTLVNPEAMPEKELPKEIQKTLPKRGECPVCLLPIQTPTACSVSGYVFCWKCIVSHMKEHGSCPVTQYPISLDDLVRIYET",
        "proteome": "UP001652628",
        "gene": "Pex12",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016558",
                "name": "protein import into peroxisome matrix",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005778",
                "name": "peroxisomal membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e0fa685fea1a1631a0b63bb3fb0d7cd22ed3a92b",
        "counters": {
            "domain_architectures": 7043,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7043
        }
    }
}