HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AB39U499",
"id": "A0AB39U499_9BIFI",
"source_organism": {
"taxId": "3059038",
"scientificName": "Bifidobacterium aquikefiricola",
"fullName": "Bifidobacterium aquikefiricola"
},
"name": "Deoxyuridine 5'-triphosphate nucleotidohydrolase",
"description": [
"This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA"
],
"length": 156,
"sequence": "MSFDEQYNEPEQSEVLIVLDGEHSVIPAYEHAGDAGADLRSSIDFTLAPFERKLIPTGIRIALPAGYVGLVHPRSGLAAKKGVTVLNTPGTIDAGYRGEIKVTLINLDAHEPAVFHVGDRIAQLVIQRYVEASFIEATTLPGSDRSDRGFGSTGIA",
"proteome": null,
"gene": "dut",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004170",
"name": "dUTP diphosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006226",
"name": "dUMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046081",
"name": "dUTP catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5adb127e6bef47e972ed9845ea1b8804ddd1e9d6",
"counters": {
"domain_architectures": 30613,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 30613
}
}
}