GET /api/protein/UniProt/A0AB39U499/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB39U499",
        "id": "A0AB39U499_9BIFI",
        "source_organism": {
            "taxId": "3059038",
            "scientificName": "Bifidobacterium aquikefiricola",
            "fullName": "Bifidobacterium aquikefiricola"
        },
        "name": "Deoxyuridine 5'-triphosphate nucleotidohydrolase",
        "description": [
            "This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA"
        ],
        "length": 156,
        "sequence": "MSFDEQYNEPEQSEVLIVLDGEHSVIPAYEHAGDAGADLRSSIDFTLAPFERKLIPTGIRIALPAGYVGLVHPRSGLAAKKGVTVLNTPGTIDAGYRGEIKVTLINLDAHEPAVFHVGDRIAQLVIQRYVEASFIEATTLPGSDRSDRGFGSTGIA",
        "proteome": null,
        "gene": "dut",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004170",
                "name": "dUTP diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006226",
                "name": "dUMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046081",
                "name": "dUTP catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5adb127e6bef47e972ed9845ea1b8804ddd1e9d6",
        "counters": {
            "domain_architectures": 30613,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 30613
        }
    }
}