HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AB37R6Z1",
"id": "A0AB37R6Z1_PSEAV",
"source_organism": {
"taxId": "53707",
"scientificName": "Pseudomonas amygdali pv. lachrymans",
"fullName": "Pseudomonas amygdali pv. lachrymans"
},
"name": "Pseudouridine synthase",
"description": [
"Responsible for synthesis of pseudouridine from uracil at positions 955, 2504 and 2580 in 23S ribosomal RNA"
],
"length": 318,
"sequence": "MTNIAPPTPGVQLVEVAPELAGQRIDNFLITYLKGVPKTLIYRILRKGEVRVNKGRIKPEYKLQAGDIVRIPPVRVPERDEPVPVAQALLQRLEAAIVYEDKALIVLNKPAGIAVHGGSGLSFGVIEAFRQLRPDAKELELVHRLDRDTSGLLMIAKKRSMLRHLHEALRGDGVDKRYMALVRGNWATAQKQVRAPLMKSNLRSGERMVEVNEEGKEALTIFKVLRRFGDFATMVEAKPVTGRTHQIRVHTLHAGHAIAGDTKYGDENFSREIRDLGGKRLFLHAYMLTVPMPDGSKLNVQAPVDEMWAKTVERLSAP",
"proteome": "UP000037943",
"gene": "ALP33_03682",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009982",
"name": "pseudouridine synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0001522",
"name": "pseudouridine synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009451",
"name": "RNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a31ded53247bb3adcd78990970b9bf9aa9cc8e4a",
"counters": {
"domain_architectures": 71804,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"smart": 1,
"profile": 1,
"cdd": 2,
"ncbifam": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 71804
}
}
}