GET /api/protein/UniProt/A0AB36TG09/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB36TG09",
        "id": "A0AB36TG09_ACETH",
        "source_organism": {
            "taxId": "1138384",
            "scientificName": "Acetivibrio thermocellus AD2",
            "fullName": "Acetivibrio thermocellus AD2"
        },
        "name": "Ribosome maturation factor RimM",
        "description": [
            "An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes"
        ],
        "length": 174,
        "sequence": "MIQYLQVGKIVNTHGIKGEVKAIPLTDNPRRFNKLKWAYVSKEISNEMPKFDIVSVKHHKNFVILKFSGIDDMNAAEKLKEHFVIIDRKDAVKLPKDTFFICDLIGMNVFDTEEKKLGVLTDVLSTGSNDVYVVKSDNNKEILIPALKSVVKKVCFEDNKMVVDLPQGLIDDEV",
        "proteome": null,
        "gene": "rimM",
        "go_terms": [
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043022",
                "name": "ribosome binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4c8aa3ee0c337892c6317aa40c054e5431a692b5",
        "counters": {
            "domain_architectures": 19462,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19462
        }
    }
}