HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AB36CWS8",
"id": "A0AB36CWS8_9PSED",
"source_organism": {
"taxId": "75612",
"scientificName": "Pseudomonas mandelii",
"fullName": "Pseudomonas mandelii"
},
"name": "Siroheme synthase",
"description": [
"Multifunctional enzyme that catalyzes the SAM-dependent methylations of uroporphyrinogen III at position C-2 and C-7 to form precorrin-2 via precorrin-1. Then it catalyzes the NAD-dependent ring dehydrogenation of precorrin-2 to yield sirohydrochlorin. Finally, it catalyzes the ferrochelation of sirohydrochlorin to yield siroheme"
],
"length": 464,
"sequence": "MDYLPLFHNLRGSRVLVVGGGEIALRKSRLLAEAGALLRVVAPEIEPQLRELVVGSGGECLLRGYVEADLDGCGLVIAATDDEPLNAQVSADSHRRCVPVNVVDAPALCSVIFPAIVDRSPLIIAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLAARFRSQVKRLFPDVQQRRAFWEDVFQGPIADRQLAGQGAEAERLMLAKINGEAPVATGEVYLVGAGPGDPDLLTFRALRLMQQADVVLYDRLVAPAILDLCRRDAERVYVGKRRADHAVPQDQINQQLVDLAKQGKRVVRLKGGDPFIFGRGGEEIEELAAHGIPFQVVPGITAASGCAAYAGIPLTHRDYAQSVRFVTGHLKDGSTDLPWADLVAPAQTLVFYMGLVGLPIICEQLIKHGRGADTPAALIQQGTTVNQRVFTGTLADLPRLVAEHEVHAPTLVIVGEVVQLREKLAWFEGAQAQV",
"proteome": "UP000182476",
"gene": "cobA",
"go_terms": [
{
"identifier": "GO:0006779",
"name": "porphyrin-containing compound biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019354",
"name": "siroheme biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004851",
"name": "uroporphyrin-III C-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043115",
"name": "precorrin-2 dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051266",
"name": "sirohydrochlorin ferrochelatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051287",
"name": "NAD binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009236",
"name": "cobalamin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "396b1b5768b7ef5c65858c076fd79ee5622a31ed",
"counters": {
"domain_architectures": 5061,
"entries": 34,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 5,
"ssf": 3,
"pfam": 4,
"cdd": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 4,
"panther": 1,
"prosite": 1,
"interpro": 13
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5061
}
}
}