GET /api/protein/UniProt/A0AB36CWS8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB36CWS8",
        "id": "A0AB36CWS8_9PSED",
        "source_organism": {
            "taxId": "75612",
            "scientificName": "Pseudomonas mandelii",
            "fullName": "Pseudomonas mandelii"
        },
        "name": "Siroheme synthase",
        "description": [
            "Multifunctional enzyme that catalyzes the SAM-dependent methylations of uroporphyrinogen III at position C-2 and C-7 to form precorrin-2 via precorrin-1. Then it catalyzes the NAD-dependent ring dehydrogenation of precorrin-2 to yield sirohydrochlorin. Finally, it catalyzes the ferrochelation of sirohydrochlorin to yield siroheme"
        ],
        "length": 464,
        "sequence": "MDYLPLFHNLRGSRVLVVGGGEIALRKSRLLAEAGALLRVVAPEIEPQLRELVVGSGGECLLRGYVEADLDGCGLVIAATDDEPLNAQVSADSHRRCVPVNVVDAPALCSVIFPAIVDRSPLIIAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLAARFRSQVKRLFPDVQQRRAFWEDVFQGPIADRQLAGQGAEAERLMLAKINGEAPVATGEVYLVGAGPGDPDLLTFRALRLMQQADVVLYDRLVAPAILDLCRRDAERVYVGKRRADHAVPQDQINQQLVDLAKQGKRVVRLKGGDPFIFGRGGEEIEELAAHGIPFQVVPGITAASGCAAYAGIPLTHRDYAQSVRFVTGHLKDGSTDLPWADLVAPAQTLVFYMGLVGLPIICEQLIKHGRGADTPAALIQQGTTVNQRVFTGTLADLPRLVAEHEVHAPTLVIVGEVVQLREKLAWFEGAQAQV",
        "proteome": "UP000182476",
        "gene": "cobA",
        "go_terms": [
            {
                "identifier": "GO:0006779",
                "name": "porphyrin-containing compound biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019354",
                "name": "siroheme biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004851",
                "name": "uroporphyrin-III C-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043115",
                "name": "precorrin-2 dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051266",
                "name": "sirohydrochlorin ferrochelatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009236",
                "name": "cobalamin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "396b1b5768b7ef5c65858c076fd79ee5622a31ed",
        "counters": {
            "domain_architectures": 5061,
            "entries": 34,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 5,
                "ssf": 3,
                "pfam": 4,
                "cdd": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 4,
                "panther": 1,
                "prosite": 1,
                "interpro": 13
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5061
        }
    }
}