GET /api/protein/UniProt/A0AB34PKU1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB34PKU1",
        "id": "A0AB34PKU1_CANAX",
        "source_organism": {
            "taxId": "1094989",
            "scientificName": "Candida albicans P78048",
            "fullName": "Candida albicans P78048"
        },
        "name": "Protein N-terminal and lysine N-methyltransferase EFM7",
        "description": [
            "S-adenosyl-L-methionine-dependent protein methyltransferase that trimethylates the N-terminal glycine 'Gly-2' of elongation factor 1-alpha, before also catalyzing the mono- and dimethylation of 'Lys-3'"
        ],
        "length": 262,
        "sequence": "MSEDEISIEGDLFEEPEGFLPERPSSHFSTYKRKIPNAEPQEITMKLVGHNPLYGHLLWNAGIYTADYLDKHSDTLVQGKKILELGAASALPSLVCSLNHAKEVIVTDYPDPDLLSHMEYSFNDLKEKTKYELSPWKVKGYIWGHDLGELLFDEPGRKLAEEEKFDLIILSDLVFNHSEHHKLLDTCRQSLKRNGGKCLVVFSPHRPYLLQDDLSFFETAKQYQFKTEKIEMVTWKPMFEEDEETADIRARVYAFFLIPEWE",
        "proteome": null,
        "gene": "EFM7",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d85bd1bd28376eba4c7f1f123f68489110ca4687",
        "counters": {
            "domain_architectures": 34527,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 34527
        }
    }
}