GET /api/protein/UniProt/A0AB34PKU1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AB34PKU1",
"id": "A0AB34PKU1_CANAX",
"source_organism": {
"taxId": "1094989",
"scientificName": "Candida albicans P78048",
"fullName": "Candida albicans P78048"
},
"name": "Protein N-terminal and lysine N-methyltransferase EFM7",
"description": [
"S-adenosyl-L-methionine-dependent protein methyltransferase that trimethylates the N-terminal glycine 'Gly-2' of elongation factor 1-alpha, before also catalyzing the mono- and dimethylation of 'Lys-3'"
],
"length": 262,
"sequence": "MSEDEISIEGDLFEEPEGFLPERPSSHFSTYKRKIPNAEPQEITMKLVGHNPLYGHLLWNAGIYTADYLDKHSDTLVQGKKILELGAASALPSLVCSLNHAKEVIVTDYPDPDLLSHMEYSFNDLKEKTKYELSPWKVKGYIWGHDLGELLFDEPGRKLAEEEKFDLIILSDLVFNHSEHHKLLDTCRQSLKRNGGKCLVVFSPHRPYLLQDDLSFFETAKQYQFKTEKIEMVTWKPMFEEDEETADIRARVYAFFLIPEWE",
"proteome": null,
"gene": "EFM7",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d85bd1bd28376eba4c7f1f123f68489110ca4687",
"counters": {
"domain_architectures": 34527,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 34527
}
}
}