GET /api/protein/UniProt/A0AB33EG21/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB33EG21",
        "id": "A0AB33EG21_9PSED",
        "source_organism": {
            "taxId": "104087",
            "scientificName": "Pseudomonas frederiksbergensis",
            "fullName": "Pseudomonas frederiksbergensis"
        },
        "name": "Bifunctional polymyxin resistance protein ArnA",
        "description": [
            "Bifunctional enzyme that catalyzes the oxidative decarboxylation of UDP-glucuronic acid (UDP-GlcUA) to UDP-4-keto-arabinose (UDP-Ara4O) and the addition of a formyl group to UDP-4-amino-4-deoxy-L-arabinose (UDP-L-Ara4N) to form UDP-L-4-formamido-arabinose (UDP-L-Ara4FN). The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides"
        ],
        "length": 664,
        "sequence": "MSAKAVVFAYHDIGCAGIESLLASGFEIAAVFTHPDDPKENAFYGSVAQLCARKGIPVHAPEDANHPLWIERISKLNPDYLFSFYYRNLLSEPLLATASKGAFNLHGSLLPRYRGRAPANWVLVNGETETGVTLHRMVKRADAGAIIAQQRVAIERADTALTLHGKLRQAASDLLRDTLPALLQGKISETPQDESKATVFGRRTPADGKLVWSKPAEELFNLVRAVTQPYPGAFCAVGEHKLIVWSADVVKGNEGQAPGRVISVDPLRIACGKDSLVINAGQRNDNGLYLSGPQLANELGLVDGSVLRGAESGRAPRRTRVLILGVNGFIGNHLSERLLRDDRYEVYGLDIGSDAIERLRSHPNFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKLVRYCVKYNKRVIFPSTSEVYGMCQDANFDEDSSNLVVGPINKQRWIYSISKQLLDRVIWAYGQKGLNFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILNLVEGTPIRLFDGGEQKRCFTDIADGVEALARIIDNDNDVCNGQIINIGNPDNEASIRQLGEELLRQFEAHPLRDNFPPFAGFRDIESKAFYGTGYQDVSHRKPSIANAKRLLDWAPTVEMKETIGNTLDFFLREAMLEIADKKR",
        "proteome": null,
        "gene": "arnA",
        "go_terms": [
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016831",
                "name": "carboxy-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016742",
                "name": "hydroxymethyl-, formyl- and related transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "afbc655f5aa123f3b68d07693952c531c1fa295b",
        "counters": {
            "domain_architectures": 2057,
            "entries": 25,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 3,
                "pfam": 3,
                "cdd": 2,
                "ncbifam": 3,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 9
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2057
        }
    }
}