General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AB33A010",
        "id": "A0AB33A010_ALTME",
        "source_organism": {
            "taxId": "1004788",
            "scientificName": "Alteromonas macleodii (strain English Channel 673)",
            "fullName": "Alteromonas macleodii (strain English Channel 673)"
        },
        "name": "Aminodeoxychorismate lyase",
        "description": [
            "Involved in the biosynthesis of p-aminobenzoate (PABA), a precursor of tetrahydrofolate. Converts 4-amino-4-deoxychorismate into 4-aminobenzoate (PABA) and pyruvate"
        ],
        "length": 288,
        "sequence": "MTIAFLNGEYMPLSEAKISPMDRGFLFGDGIYEVIPTYSGSAVGFKGHTSRMAQGLKAIEIANPYSAEEWQDILTSLVEKNKAFIESGNIGVYFHVSRGTDTKRFHAYPKNIAPTVFGFAFEIAPPQPTAKSEARPFKVALQQDKRWQRCHIKSTSLLGNVMHYQAGVDAGVNETILYNSEGMITEASSCNVFMVKNGCISTPPLNHELLPGITRAIAIEAFKQAGLVVTETWFSKDELLEADEVWLTSSSKEVAPVVEVDGKPIGTGEVGDVWEKAIKAYHAYKFKA",
        "proteome": null,
        "gene": "AMEC673_10955",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c8cf9b0777e925f72b88b5d6f7ebb434bd00bc5",
        "counters": {
            "domain_architectures": 76076,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 76076
        }
    }
}