GET /api/protein/UniProt/A0AAZ1Y3M2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAZ1Y3M2",
"id": "A0AAZ1Y3M2_OREAU",
"source_organism": {
"taxId": "47969",
"scientificName": "Oreochromis aureus",
"fullName": "Oreochromis aureus (Israeli tilapia)"
},
"name": "Gamma-glutamylcyclotransferase",
"description": [
"Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides"
],
"length": 184,
"sequence": "MWVFGYGSLIWKVDFPYEEKRIGYIKGFSRRFWQGSTDHRGVPGKPGRVVTLVENPEGCVWGVAYKLPTGREEEVKRYLDYREKGGYQVVTVTFHPRPSLTCSPSQTLIYIGSKDNPNYLGPAPLEEIANQIINSTGPSGKNTEYLFQLADAVRTFLPEDSDTHLFSLETLVRERLENGQKNSI",
"proteome": "UP000472276",
"gene": "CHAC2",
"go_terms": [
{
"identifier": "GO:0061928",
"name": "glutathione specific gamma-glutamylcyclotransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006751",
"name": "glutathione catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d7339725ab49c2b7cf5d94f1d9bf486fc14c811e",
"counters": {
"domain_architectures": 12445,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12445
}
}
}