GET /api/protein/UniProt/A0AAY5L2I5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAY5L2I5",
"id": "A0AAY5L2I5_ESOLU",
"source_organism": {
"taxId": "8010",
"scientificName": "Esox lucius",
"fullName": "Esox lucius (Northern pike)"
},
"name": "Phospholipid phosphatase 3",
"description": [
"Independently of this phosphatase activity may also function in the Wnt signaling pathway and the stabilization of beta-catenin/CTNNB1, thereby regulating cell proliferation, migration and differentiation in angiogenesis or yet in tumor growth. Also plays a role in integrin-mediated cell-cell adhesion in angiogenesis"
],
"length": 302,
"sequence": "MAQQTRNGGTSLNNNNGIDNTKRKLLIGLDLFCLLLVMLPSLALHRSSVRPYQRGFYCSDVSLRYSYKNSTVPSSVLTAVGLTLPSVAIVIGECYRINHLREGSKSFIGNPYVSSLYKQVGVFIFGCAVSQSFTDIAKVSVGRMRPHFLDVCKPDWSTINCSEGYITSYTCTGPESKVQEARKSFFSGHASFSMFTMLYLAFYLQSRFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDHKHHPTDVLAGFVQGALVAYCIVFYVSDLFKPRVKPASPPPSPIKKELLPPADIIERNNHHNMV",
"proteome": "UP000265140",
"gene": null,
"go_terms": [
{
"identifier": "GO:0006644",
"name": "phospholipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ff308a62e727406a341790172e35cf62f6fc2c9c",
"counters": {
"domain_architectures": 108244,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"smart": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 108244
}
}
}