GET /api/protein/UniProt/A0AAY5L2I5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAY5L2I5",
        "id": "A0AAY5L2I5_ESOLU",
        "source_organism": {
            "taxId": "8010",
            "scientificName": "Esox lucius",
            "fullName": "Esox lucius (Northern pike)"
        },
        "name": "Phospholipid phosphatase 3",
        "description": [
            "Independently of this phosphatase activity may also function in the Wnt signaling pathway and the stabilization of beta-catenin/CTNNB1, thereby regulating cell proliferation, migration and differentiation in angiogenesis or yet in tumor growth. Also plays a role in integrin-mediated cell-cell adhesion in angiogenesis"
        ],
        "length": 302,
        "sequence": "MAQQTRNGGTSLNNNNGIDNTKRKLLIGLDLFCLLLVMLPSLALHRSSVRPYQRGFYCSDVSLRYSYKNSTVPSSVLTAVGLTLPSVAIVIGECYRINHLREGSKSFIGNPYVSSLYKQVGVFIFGCAVSQSFTDIAKVSVGRMRPHFLDVCKPDWSTINCSEGYITSYTCTGPESKVQEARKSFFSGHASFSMFTMLYLAFYLQSRFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDHKHHPTDVLAGFVQGALVAYCIVFYVSDLFKPRVKPASPPPSPIKKELLPPADIIERNNHHNMV",
        "proteome": "UP000265140",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006644",
                "name": "phospholipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff308a62e727406a341790172e35cf62f6fc2c9c",
        "counters": {
            "domain_architectures": 108244,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 108244
        }
    }
}