HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAX7UVH7",
"id": "A0AAX7UVH7_ASTCA",
"source_organism": {
"taxId": "8154",
"scientificName": "Astatotilapia calliptera",
"fullName": "Astatotilapia calliptera (Eastern happy)"
},
"name": "Sodium/potassium-transporting ATPase subunit beta",
"description": [
"This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane"
],
"length": 302,
"sequence": "MPSDKKDDGGWKKFLWNSETGELLGRTGGSWFKITLFYVIFYGCLAGIFIGTIQAMLLTLSEYKPTWQDRVAPPGLTHTPRSDKAEMAFNPRAVETFLPHTKALREFLDKYDESKQKDQMKFEDCGDQPADYKNRGDLDSDVGVRKACRFSRALLGPCSGLEDTEFGFKEGKPCLIVKLNRIVNYRPRPPTSNESIPEEAQPKVQPNVIPIYCTSKKEEDADKIGEIKYYGIGEGFPLQYYPYYGKKLHPQYLQPLVALQFTNLTRNTDLRIECKVFGDNIDYSEKDRYQGRFEIKIQVEES",
"proteome": "UP000265100",
"gene": null,
"go_terms": [
{
"identifier": "GO:0006813",
"name": "potassium ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006814",
"name": "sodium ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005890",
"name": "sodium:potassium-exchanging ATPase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "edc17df419148265b8eea0f3941c45befc5b4f1c",
"counters": {
"domain_architectures": 7935,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 2,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7935
}
}
}