HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAX6QS06",
"id": "A0AAX6QS06_HETGA",
"source_organism": {
"taxId": "10181",
"scientificName": "Heterocephalus glaber",
"fullName": "Heterocephalus glaber (Naked mole rat)"
},
"name": "AP-3 complex subunit delta-1",
"description": [
"Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation",
"Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. Involved in process of CD8+ T-cell and NK cell degranulation. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals"
],
"length": 181,
"sequence": "MLGVEETSWSYLFHYICQDRIVYLCITDDDFERSRAFNFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKYHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNIKLTIIIIIVSIVFIYIIVSSLCGGFTWPSCVKK",
"proteome": "UP000694906",
"gene": "Vamp7",
"go_terms": [
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e09a1477707fd7f9badcb09d6cf1d43f3f6a69d9",
"counters": {
"domain_architectures": 17217,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"profile": 2,
"cdd": 2,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17217
}
}
}