General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAX6PWM2",
        "id": "A0AAX6PWM2_HETGA",
        "source_organism": {
            "taxId": "10181",
            "scientificName": "Heterocephalus glaber",
            "fullName": "Heterocephalus glaber (Naked mole rat)"
        },
        "name": "Ankyrin repeat and SOCS box protein 10",
        "description": [
            "May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins"
        ],
        "length": 467,
        "sequence": "MLMSWSPDQCQGQGQPLGDRHTLCARLVERPHGGSEELPESGPGPIATRTASGPALAFWQAVLAGDVGSVSRILSDSHTSLAPDSVFDTSDPERWRDFRYNIRALRLWSLTYQEELTTPLHVAASRGHTEVLQLLLRRRAQPDSAPGGRTALHEACAAGHTACVHVLLVAGADPNLPDQDGKRPLHLCRGPGTLQCADLLLRFGAQVDGRSEEEEETPLHTAARLGHVELADLLLRRGACPDARNAEGWTPLLAACDTRCQSSADAEATSARCFQLCHLLLSAGADADAADQDRQRPLHLACRRGHVAVVELLLSCGVSANAMDYGGHTALHCALQGPAAALAQTPEHVVRALLNHGAVRVWPGALPKVLERWCSSPRTIEVLMNTYSVVRLPEEAVGLIPPEMLQKHQRFYSSLFALVRQPRSLQHLSRCTLRAHLAGCLPLTLPRLPLPPRLLRYLQLEFEDVLY",
        "proteome": "UP000694906",
        "gene": "Asb10",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15f5b9919bbc8ac4a238c47197b1d84638fc37b5",
        "counters": {
            "domain_architectures": 586,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "profile": 3,
                "smart": 2,
                "pfam": 3,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 586
        }
    }
}