HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAX4FH02",
"id": "A0AAX4FH02_XANEU",
"source_organism": {
"taxId": "456327",
"scientificName": "Xanthomonas euvesicatoria",
"fullName": "Xanthomonas euvesicatoria"
},
"name": "Dihydrofolate synthase/folylpolyglutamate synthase",
"description": [
"Functions in two distinct reactions of the de novo folate biosynthetic pathway. Catalyzes the addition of a glutamate residue to dihydropteroate (7,8-dihydropteroate or H2Pte) to form dihydrofolate (7,8-dihydrofolate monoglutamate or H2Pte-Glu). Also catalyzes successive additions of L-glutamate to tetrahydrofolate or 10-formyltetrahydrofolate or 5,10-methylenetetrahydrofolate, leading to folylpolyglutamate derivatives"
],
"length": 432,
"sequence": "MNATDSLSAWLAYIEQQHPSAIAMGLERVRAVAARLQLAAPATHVIVVGGTNGKGSTVAFIEAIGRAAGWKVGAYTSPHLLRYNERVRIDGEEASDAQLVDAFAAVEAARGDTALTYFEFGTLAALWLFQQSALELAVLEIGLGGRLDAVNIVDSDVAVITTVDLDHTDWLGEDREAIGAEKAGIIRAWKPVVLGEIDPPSSVLRRAYQLGANAIRAGSDYFFEPIDTPHAESPQPDAPRWRWRDVAVTLELPMPALRAPVQLANAAAAIAALQALPVEVPDAAWAQGIGNAQVAGRLQRLEADGVQVLLDVGHNPQAARALAAALGTQAHAGRTYAIYAALVDKDVLGVVEAVAGQIDHWALAGLEGARGQSAQALQARLQGSAAAQAPCHRDVASAVRAVLDTASPGDRVLVFGSFHTVADALDALHSAR",
"proteome": null,
"gene": "folC",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016881",
"name": "acid-amino acid ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004326",
"name": "tetrahydrofolylpolyglutamate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009396",
"name": "folic acid-containing compound biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e6ab2b5b1f832ff43dbb14fcfeb9fea358486a52",
"counters": {
"domain_architectures": 37786,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 37786
}
}
}