GET /api/protein/UniProt/A0AAW7HLT0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAW7HLT0",
        "id": "A0AAW7HLT0_9PSED",
        "source_organism": {
            "taxId": "1940621",
            "scientificName": "Pseudomonas alloputida",
            "fullName": "Pseudomonas alloputida"
        },
        "name": "NAD-capped RNA hydrolase NudC",
        "description": [
            "mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA. The NAD-cap is present at the 5'-end of some mRNAs and stabilizes RNA against 5'-processing. Has preference for mRNAs with a 5'-end purine. Catalyzes the hydrolysis of a broad range of dinucleotide pyrophosphates"
        ],
        "length": 276,
        "sequence": "MSARWTTAVLDPQMTGGLAVARSPEGFLVDANGALFPRDWLKRQDLDVLCEHGIGHFDGQPVFLLELRSATDVPGCSWRGLRAFMLEGDFDTYKVLGYAAQIGIWAREHRFCGSCGQPMTQIRWERAMYCQPCDLRSYPRISPSMIVLVTRGDEILLARSPRFVTGVYSTLAGFAEPGESAEDCLVREVREEVAVEVKNIQYVGSQCWPFPHSMMLGFHAEYAGGEIVMQPDEIEDAKWFSVHDLPPLPAGRSIARYLIDLYVARRLGCDIPAFPS",
        "proteome": null,
        "gene": "nudC",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000210",
                "name": "NAD+ diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "837362ac5dc5a39ffe60f6af33453e1483a85606",
        "counters": {
            "domain_architectures": 8878,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 3,
                "profile": 1,
                "cdd": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8878
        }
    }
}