GET /api/protein/UniProt/A0AAV9NVZ8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAV9NVZ8",
"id": "A0AAV9NVZ8_9EURO",
"source_organism": {
"taxId": "1690606",
"scientificName": "Exophiala bonariae",
"fullName": "Exophiala bonariae"
},
"name": "Acyl-protein thioesterase 1",
"description": [
"Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo"
],
"length": 233,
"sequence": "MANKAALVVPAIKKHTATVIMAHGLGDSGAGWVSLAESWRRRGKFEDVKFIFPNAPNIPITVNMGMHMPGWYDITNFDDLKQAHDEVGILRSRGVFTKFITDEVAAGIPSNRIILGGFSQGGAISLFTGLTTPHKLGGVFGLSCYLVLGDKIKDFVKEASEANKDTPFFMAHGDVDQVVKFAWGQQTSEVLQKELGHKVDFKVYRGLGHSADMKEIDDLEKFIKDCLPASEAL",
"proteome": "UP001358417",
"gene": "LTR84_001140",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "480047bf4951157f05965ce351dd9692ddf52b46",
"counters": {
"domain_architectures": 32952,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32952
}
}
}