GET /api/protein/UniProt/A0AAV9NVZ8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAV9NVZ8",
        "id": "A0AAV9NVZ8_9EURO",
        "source_organism": {
            "taxId": "1690606",
            "scientificName": "Exophiala bonariae",
            "fullName": "Exophiala bonariae"
        },
        "name": "Acyl-protein thioesterase 1",
        "description": [
            "Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo"
        ],
        "length": 233,
        "sequence": "MANKAALVVPAIKKHTATVIMAHGLGDSGAGWVSLAESWRRRGKFEDVKFIFPNAPNIPITVNMGMHMPGWYDITNFDDLKQAHDEVGILRSRGVFTKFITDEVAAGIPSNRIILGGFSQGGAISLFTGLTTPHKLGGVFGLSCYLVLGDKIKDFVKEASEANKDTPFFMAHGDVDQVVKFAWGQQTSEVLQKELGHKVDFKVYRGLGHSADMKEIDDLEKFIKDCLPASEAL",
        "proteome": "UP001358417",
        "gene": "LTR84_001140",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "480047bf4951157f05965ce351dd9692ddf52b46",
        "counters": {
            "domain_architectures": 32952,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32952
        }
    }
}