GET /api/protein/UniProt/A0AAV6SE69/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAV6SE69",
        "id": "A0AAV6SE69_SOLSE",
        "source_organism": {
            "taxId": "28829",
            "scientificName": "Solea senegalensis",
            "fullName": "Solea senegalensis (Senegalese sole)"
        },
        "name": "RNA-binding protein Musashi homolog 2",
        "description": [
            "RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system"
        ],
        "length": 347,
        "sequence": "MEGDGSQATSGSLNDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLSYPNIVATYGRGYTGFAPSYSYQFPGFPATAYGPVAAAAVAAARGSGRGARGRGGYLAYPQSTGPGTNPSRPGGFPGANSPGPVADLYGPSSQDSAVGNYISAASPQPGSGFGPSITGPLIATAFTNGYH",
        "proteome": "UP000693946",
        "gene": "JOB18_014495",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4059ea5eee6f538d81548f164be416a9befcb0ea",
        "counters": {
            "domain_architectures": 109335,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 109335
        }
    }
}