General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAV6QQQ3",
        "id": "A0AAV6QQQ3_SOLSE",
        "source_organism": {
            "taxId": "28829",
            "scientificName": "Solea senegalensis",
            "fullName": "Solea senegalensis (Senegalese sole)"
        },
        "name": "Transcription factor HES-5",
        "description": [
            "Transcriptional repressor of genes that require a bHLH protein for their transcription. Plays an important role as neurogenesis negative regulator"
        ],
        "length": 152,
        "sequence": "MKPAEIRFSLQRPLQHTDPDMAPTITAALTNSQEHLTLTHKLRKPLVEKLRRERINSSIEQLKSLLGPEFLKQQPDSKLEKADILEMTVCVLTQLQQHNQQQRRLMMKNFNKLQSSSDKNLTEADFSPLSSTDQTSITKDKSPVHSAPWRPW",
        "proteome": "UP000693946",
        "gene": "JOB18_050023",
        "go_terms": [
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15b86a07eaabcbc71b6ebb705399c8a22c21f484",
        "counters": {
            "domain_architectures": 146351,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 146351
        }
    }
}