General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAV3JW84",
        "id": "A0AAV3JW84_ACIBA",
        "source_organism": {
            "taxId": "1358412",
            "scientificName": "Acinetobacter baumannii EGD-HP18",
            "fullName": "Acinetobacter baumannii EGD-HP18"
        },
        "name": "Peptide methionine sulfoxide reductase MsrA",
        "description": [
            "Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine"
        ],
        "length": 173,
        "sequence": "MQQALFGGGCFWCVEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFATHDPTTLNRQGNDIGTQYRSVIYYFNEEQKQAAEHTIQTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQGYCNFAIPPKLLKLHSKFQHLMKN",
        "proteome": null,
        "gene": "msrA",
        "go_terms": [
            {
                "identifier": "GO:0008113",
                "name": "peptide-methionine (S)-S-oxide reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "47a64c36b2d13edfc0db84d999e2ce356181eb1f",
        "counters": {
            "domain_architectures": 38973,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 38973
        }
    }
}