GET /api/protein/UniProt/A0AAV3JG85/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAV3JG85",
"id": "A0AAV3JG85_LEPBO",
"source_organism": {
"taxId": "1049767",
"scientificName": "Leptospira borgpetersenii serovar Javanica str. UI 09931",
"fullName": "Leptospira borgpetersenii serovar Javanica str. UI 09931"
},
"name": "Sec-independent protein translocase protein TatA",
"description": [
"Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system"
],
"length": 85,
"sequence": "MFAPLAIFGSLGWTEILLILFIALLLFGGKRLPSLAKDLGDGIRSFRKSLMGESDDSSQQIGQEQVQSASKEESKNSKSKKSKSV",
"proteome": null,
"gene": "tatA",
"go_terms": [
{
"identifier": "GO:0043953",
"name": "protein transport by the Tat complex",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015031",
"name": "protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8e9933fb82f0f1a021a5c55eb56f620d16af2308",
"counters": {
"domain_architectures": 47020,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"prints": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 47020
}
}
}