GET /api/protein/UniProt/A0AAV3ICR7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAV3ICR7",
"id": "A0AAV3ICR7_HELPX",
"source_organism": {
"taxId": "1159029",
"scientificName": "Helicobacter pylori GAM120Ai",
"fullName": "Helicobacter pylori GAM120Ai"
},
"name": "3-methyl-2-oxobutanoate hydroxymethyltransferase",
"description": [
"Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha-ketoisovalerate to form ketopantoate"
],
"length": 270,
"sequence": "MSMQTAPIKKITLSHLQAKKNQEKIIAITAYDALFAQIFDPLVDVILVGDSLNMSFFNQNDTLSASVGMMLYHTKAVCAGAKTPFIITDMPFGSYKDEKTALKNAIRVYKETQASAIKLEGGKEKAKLVKTLTNEGVIVVGHIGLMPQFVRLDGGYKIKGKNEEQQKKLLEDALSLEEAGVGLLVLEGITTPIAQTITQKIKIPTIGIGSGKDCDGQILVWSDMLGFFDSFKPKFVREYLKGKELIQNALQQYADDVKKGNFPNELESYH",
"proteome": null,
"gene": "panB",
"go_terms": [
{
"identifier": "GO:0003864",
"name": "3-methyl-2-oxobutanoate hydroxymethyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015940",
"name": "pantothenate biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5602c26eabd87cc0f9b0397d62f503eae2a6be98",
"counters": {
"domain_architectures": 25533,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 2,
"pfam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 25533
}
}
}