General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAU9ZKA9",
        "id": "A0AAU9ZKA9_PHORO",
        "source_organism": {
            "taxId": "109678",
            "scientificName": "Phodopus roborovskii",
            "fullName": "Phodopus roborovskii (Roborovski's desert hamster)"
        },
        "name": "Glutathione S-transferase LANCL1",
        "description": [
            "Functions as a glutathione transferase. Catalyzes conjugation of the glutathione (GSH) to artificial substrates 1-chloro-2,4-dinitrobenzene (CDNB) and p-nitrophenyl acetate. Mitigates neuronal oxidative stress during normal postnatal development and in response to oxidative stresses probably through GSH antioxidant defense mechanism. May play a role in EPS8 signaling. Binds glutathione"
        ],
        "length": 399,
        "sequence": "MAQRAFPNPHADYNKSLAESYFDSTGRLTPEFSQRLTIKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYVKQSLNCLSKRSITFLCGDAGPLAVAAVLYHKMKSEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQQICETILNSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLRVSQAKLHSLVKPSVDFVCQLKFPSGNFPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEEQYLCDAYKCADVVWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDVKYLYRACKFAEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL",
        "proteome": "UP001152836",
        "gene": "Lancl1",
        "go_terms": [
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0031179",
                "name": "peptide modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a637eedecf8cd348ef6d75ddfc7e0fd81374d56d",
        "counters": {
            "domain_architectures": 10612,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10612
        }
    }
}