GET /api/protein/UniProt/A0AAU9Z9T4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAU9Z9T4",
        "id": "A0AAU9Z9T4_PHORO",
        "source_organism": {
            "taxId": "109678",
            "scientificName": "Phodopus roborovskii",
            "fullName": "Phodopus roborovskii (Roborovski's desert hamster)"
        },
        "name": "Regulator of G-protein signaling 5",
        "description": [
            "Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha"
        ],
        "length": 193,
        "sequence": "MAQLVTELSLSSVSGKHNKLDAVDHSCNLEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKTHKPSLDEALQWRHSLDKLLHNNYGLATFKSFLKSEFSEENLEFWVACEDYKKIKSPVKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRVHALMEKDSLPRFVRSKFYRELIK",
        "proteome": "UP001152836",
        "gene": "Rgs5",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3962b823cbd84ba1c9ff3d7eb9ca5befd0245855",
        "counters": {
            "domain_architectures": 22883,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22883
        }
    }
}