GET /api/protein/UniProt/A0AAU8PCB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAU8PCB8",
        "id": "A0AAU8PCB8_DESK7",
        "source_organism": {
            "taxId": "760568",
            "scientificName": "Desulfofundulus kuznetsovii (strain DSM 6115 / VKM B-1805 / 17)",
            "fullName": "Desulfofundulus kuznetsovii (strain DSM 6115 / VKM B-1805 / 17)"
        },
        "name": "Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit",
        "description": [
            "Responsible for channeling the electrons from the oxidation of dihydroorotate from the FMN redox center in the PyrD type B subunit to the ultimate electron acceptor NAD(+)"
        ],
        "length": 264,
        "sequence": "MVADMPANIVQQEQVGPGQYRLTLYAPVIASCAVPGQFVYIRCTGSLDPMLRRPLSIHGVNRRKGEVLFLYQVVGRGTALLAAKRNGEQLAVMGPLGRGFTLPEPGQRVVLVGGGIGVAPLVFLGHELVQRKNQVCLLVGARSAHQLPVGKEGYTAPFELAVATDDGSCGHHGPVTDLLEKILAGEGADMVYACGPRHMLRQTASLLARFGVPGEFSLEERMGCGVGACLSCVCKTAGKGGEPFRYRRVCVEGPVFPADQLVWD",
        "proteome": "UP000009229",
        "gene": "pyrK",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051537",
                "name": "2 iron, 2 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006221",
                "name": "pyrimidine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "515b30940682b2e2c813a561c155797c96c45d00",
        "counters": {
            "domain_architectures": 6440,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 3,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6440
        }
    }
}