GET /api/protein/UniProt/A0AAU7KPG3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAU7KPG3",
        "id": "A0AAU7KPG3_9GAMM",
        "source_organism": {
            "taxId": "2950874",
            "scientificName": "Halomonas sp. H10-59",
            "fullName": "Halomonas sp. H10-59"
        },
        "name": "Xanthine-guanine phosphoribosyltransferase",
        "description": [
            "Purine salvage pathway enzyme that catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of the 6-oxopurines guanine and xanthine to form the corresponding ribonucleotides GMP (guanosine 5'-monophosphate) and XMP (xanthosine 5'-monophosphate), with the release of PPi. To a lesser extent, also acts on hypoxanthine"
        ],
        "length": 158,
        "sequence": "MSSQRYHRHFVVSWDQLHRDVRELCHRLIERDTKGIIAITRGGLIPAALIARELNVRLIDTVCIKSYDHMEQDSLEVLKGVDHDGEGWLLVDDLVDTGKTARKVREMLPKAHFVTIYAKPEGRPLVDQYLTEVAQDCWIQFPWDMGVAYVEPLADQRR",
        "proteome": null,
        "gene": "gpt",
        "go_terms": [
            {
                "identifier": "GO:0000310",
                "name": "xanthine phosphoribosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0f8ac38f062a402c09070bf5cbec330fb03fbefd",
        "counters": {
            "domain_architectures": 136430,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 136430
        }
    }
}