HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAU7FCN1",
"id": "A0AAU7FCN1_9BACI",
"source_organism": {
"taxId": "3153756",
"scientificName": "Bacillus sp. BS1807G30",
"fullName": "Bacillus sp. BS1807G30"
},
"name": "Dihydroxy-acid dehydratase",
"description": [
"Functions in the biosynthesis of branched-chain amino acids. Catalyzes the dehydration of (2R,3R)-2,3-dihydroxy-3-methylpentanoate (2,3-dihydroxy-3-methylvalerate) into 2-oxo-3-methylpentanoate (2-oxo-3-methylvalerate) and of (2R)-2,3-dihydroxy-3-methylbutanoate (2,3-dihydroxyisovalerate) into 2-oxo-3-methylbutanoate (2-oxoisovalerate), the penultimate precursor to L-isoleucine and L-valine, respectively"
],
"length": 558,
"sequence": "MAELRSNMIKQGIDRAPHRSLLRAAGVKDEDFGKPFIAVCNSYIDIVPGHVHLQEFGKIVKEAIREAGGVPFEFNTIGVDDGIAMGHIGMRYSLPSREIIADSVETVVSAHWFDGMVCIPNCDKITPGMMMAAMRVNIPTVFVSGGPMEAGRTSDGRKISLSSVFEGVGAYQSGKINEEELNELEQFGCPTCGSCSGMFTANSMNCLAEALGIALPGNGTILATSPERREFAKKSAKQLMELIKKDIKPRDIVTEKAIDNAFALDMALGGSTNTVLHTLAIANEAGVEYSLERINEVAERVPHLSKLAPASDVYIEDLHEAGGVTAALNELSKKEGALHLDTMTVTAKTLGENIAGHEVKDYNVIYPIDKPFTEKGGLAVLFGNLAPDGAIIKTGGVQDGITRHEGPAIVFESQEEALEGIINRKVEAGHVVIIRYEGPKGGPGMPEMLAPTSQIVGMGLGPKVALITDGRFSGASRGLSIGHVSPEAAEGGPLAFVENGDHVVVDIEKRILSVDVPEEEWEKRKANWKGFEPKVKTGYLARYSKLVTSANTGGIMKI",
"proteome": null,
"gene": "ilvD",
"go_terms": [
{
"identifier": "GO:0004160",
"name": "dihydroxy-acid dehydratase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009082",
"name": "branched-chain amino acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "20dbcf2b42e05607c0e091533fa6941e21b50864",
"counters": {
"domain_architectures": 52946,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"pfam": 2,
"cathgene3d": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 52946
}
}
}