GET /api/protein/UniProt/A0AAU0Q1J4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAU0Q1J4",
"id": "A0AAU0Q1J4_9CORY",
"source_organism": {
"taxId": "2804917",
"scientificName": "Corynebacterium pseudokroppenstedtii",
"fullName": "Corynebacterium pseudokroppenstedtii"
},
"name": "Putative pre-16S rRNA nuclease",
"description": [
"Could be a nuclease involved in processing of the 5'-end of pre-16S rRNA"
],
"length": 178,
"sequence": "MPSLITLRSRDNLLVKNIVPDRPGEDDPGPGRRLGLDVGTVRIGVAVSDPDGILATPVSTVARTTKRRGPDGEDIDSIVQLAHDYSVVEVIVGLPRMLDGSAGSSVKHAQDVGFRVRRRLERDGVDVPIRYVDERMTTVMAQSNLHDAGISVKEGRSIIDQAAAVEILQTWLDQRPRR",
"proteome": "UP001174314",
"gene": "ruvX",
"go_terms": [
{
"identifier": "GO:0006139",
"name": "nucleobase-containing compound metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ae173ed84f2e53482ced8e6b50a39f6314c11faa",
"counters": {
"domain_architectures": 26346,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26346
}
}
}