HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAT9DX21",
"id": "A0AAT9DX21_SERMA",
"source_organism": {
"taxId": "1334564",
"scientificName": "Serratia marcescens SM39",
"fullName": "Serratia marcescens SM39"
},
"name": "L-lactate dehydrogenase",
"description": [
"Catalyzes the conversion of L-lactate to pyruvate. Is coupled to the respiratory chain"
],
"length": 379,
"sequence": "MIISASTDYRAAAQAKLPPFLFHYIDGGAYAEHTLKRNTADLADIALRQRVLRNMSELSLQTTLFGEQLAMPVALGPVGLTGMYARRGEVQAARAAAKKGIPFTLSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPVPGARYRDAHSGMSGPNAALRRVLQAFAHPQWAWDVGLLGKPHDLGNVSAYRGKPTSLEDYIGWLGANFDPSISWKDLEWIREFWDGPMIIKGILDPEDAKDAVRFGADGIIVSNHGGRQLDGVLSTARAMPAIADAVKGDITLLADSGIRSGLDVVRMIALGADSVLLGRAFVYALAAAGEAGVANLLDLIDKEMRVAMTLTGAKTIAEINAGSLVRNA",
"proteome": null,
"gene": "lldD",
"go_terms": [
{
"identifier": "GO:0010181",
"name": "FMN binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004457",
"name": "lactate dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006089",
"name": "lactate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d098250550c46cb4d190107fc65c607b9f37bdbd",
"counters": {
"domain_architectures": 39725,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 39725
}
}
}