GET /api/protein/UniProt/A0AAR2JQN5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAR2JQN5",
"id": "A0AAR2JQN5_PYGNA",
"source_organism": {
"taxId": "42514",
"scientificName": "Pygocentrus nattereri",
"fullName": "Pygocentrus nattereri (Red-bellied piranha)"
},
"name": "RNA-binding protein Musashi homolog 2",
"description": [
"RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system"
],
"length": 402,
"sequence": "MDGDGSQATSGSPNDTQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLSYPNIVATYGRGYTGFAPSYSYQFPGFPATAYGPVAAAAAVAAARGSGRGARGRGGYVAYPQNSGPGFPDYGFYSAPSDQRGAPCSFADYGSLGPQAAQMLQSEHATSACNSPLQHLHSPDQFKSPGTNPPRPGGFPGANSPGPVADLYGPASQDSAVGNYISAASPQPGSGFSHSIAVTGYHLL",
"proteome": "UP001501920",
"gene": "MSI2",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4059ea5eee6f538d81548f164be416a9befcb0ea",
"counters": {
"domain_architectures": 109335,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 109335
}
}
}