HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAR2JGN7",
"id": "A0AAR2JGN7_PYGNA",
"source_organism": {
"taxId": "42514",
"scientificName": "Pygocentrus nattereri",
"fullName": "Pygocentrus nattereri (Red-bellied piranha)"
},
"name": "Mitochondrial glycine transporter",
"description": [
"May play a role as pro-apoptotic protein that induces caspase-dependent apoptosis",
"Mitochondrial glycine transporter that imports glycine into the mitochondrial matrix. Plays an important role in providing glycine for the first enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) in the miochondrial matrix. Required during erythropoiesis"
],
"length": 299,
"sequence": "MQEKKDAQPKSASGLGKAHPALKAFMCGSLSGTCSTLLFQPLDLVKTRLQTLQNSLSPGSPKVGMLSVFITVVRTEKLFGLWKGVSPSFMRCIPGVGIYFSTFYSLKQHFFEDRAPNAGEAVLLGAGARCVAGVAMLPVTVIKTRFESGRYNYVSVFGALRSVCQTEGPRALYSGLTATLLRDAPFSGIYVMFYSQAKRVLPHEISSSGLAPVVNFGCGVLAGILASFVTQPADVVKTHMQVSPALYRRTSDAIRFVYSEHGLGGFFRGAVPRSLRRTLMAAMAWTVYEQLMARMGLKS",
"proteome": "UP001501920",
"gene": "SLC25A38",
"go_terms": [
{
"identifier": "GO:0015187",
"name": "glycine transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1904983",
"name": "glycine import into mitochondrion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005743",
"name": "mitochondrial inner membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}