General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAP9WG60",
        "id": "A0AAP9WG60_LEPIR",
        "source_organism": {
            "taxId": "312175",
            "scientificName": "Leptospira interrogans serovar Bataviae",
            "fullName": "Leptospira interrogans serovar Bataviae"
        },
        "name": "Chorismate synthase",
        "description": [
            "Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch point compound that serves as the starting substrate for the three terminal pathways of aromatic amino acid biosynthesis. This reaction introduces a second double bond into the aromatic ring system"
        ],
        "length": 380,
        "sequence": "MPSSWGKIFKVSTFGESHGTSVGVVVEGVPAGIPIRLEEIQKDLNRRRPGQSNLTTPRDETDTVRVVSGVFEGKTIGSPIALIVDNQNTISKDYENLRTTFRPSHADYTYQMKYGFRAHVGGGRSSVRETIGRVAAAAIARMILKDDLGIETIAWVDSIGTVQSNIGDKYPKSREEVDQNEVRCPDVGSADQMRSLILKMKEAGDSVGGTIQCVSYNLPPGLGDPVYDKLDGDLAKAILSIPACKGFEVGSGFSGTLLTGSSHNDEFYVEEGTGRVRTRTNHSGGLQGGISNGEELVIRAAFKPTSTIFKKQNTINLKGEETILEAKGRHDPCVLPRAVPIIEAVVNLVLIDAYLYQRAINPQWFQKWARIPDYYKDLEL",
        "proteome": null,
        "gene": "aroC",
        "go_terms": [
            {
                "identifier": "GO:0004107",
                "name": "chorismate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009073",
                "name": "aromatic amino acid family biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3e0fd8c230acfdab01d91359ddc497e6d6a0caaf",
        "counters": {
            "domain_architectures": 29161,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 2,
                "hamap": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 29161
        }
    }
}