General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAP4Q325",
        "id": "A0AAP4Q325_BACTU",
        "source_organism": {
            "taxId": "1428",
            "scientificName": "Bacillus thuringiensis",
            "fullName": "Bacillus thuringiensis"
        },
        "name": "Immunity protein SdpI",
        "description": [
            "Immunity protein that provides protection for the cell against the toxic effects of SDP, its own SdpC-derived killing factor, and that functions as a receptor/signal transduction protein as well. Once SDP accumulates in the extracellular milieu, SdpI binds to SDP, causing sequestration of SdpR at the bacterial membrane"
        ],
        "length": 211,
        "sequence": "MKKHLFAILLIVITCLAWAFAWPHLPDTIATHWSGGKVDGYSSKLYGMLSMVGIMIVLYIFLNVLPKIDPKKANYEKFSKAFMMMNNGILLLLFVGNIDIITSGLGYNLFINRVPELLVGILFIVIGNYLPQCKPNYFVGIKTPWTLSSEEVWRKTHRFSGKVFVALGIIMILSVFAPVTWKSFVMVGIIIGAVGLTMGYSYIAYKKEIGA",
        "proteome": null,
        "gene": "FLM80_06530",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b9a7b95cc1e4214d7a22d52404287418e0a93e73",
        "counters": {
            "domain_architectures": 2384,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "panther": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2384
        }
    }
}