HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAN4KS49",
"id": "A0AAN4KS49_BACTU",
"source_organism": {
"taxId": "1324966",
"scientificName": "Bacillus thuringiensis T01-328",
"fullName": "Bacillus thuringiensis T01-328"
},
"name": "Flagellar biosynthesis protein FlhF",
"description": [
"Necessary for flagellar biosynthesis. May be involved in translocation of the flagellum"
],
"length": 436,
"sequence": "MESTEKKEALMRIKAASKNELYRKLFDQYGTDYYYVVDESVKRNIPFFWKKDYEMLVAFPEEKQEEVNEGTAQFHEQLMDVVNDPSEQIVKANGIQSVLHNLENVTTSMSYAAMQTGNSEEWARKKEKLLKLFEKGIVVVKQTKETEVPKKKKVVKQVVPVKKEEVVPKKENQESVPFIIQKVIRMLEQNDVEQYFIYAYAEKLKIKFENATMITEEEVIRYILEDMKSHFNTENVFEKEVQTIALIGPTGVGKTTTLAKMAWQFHGKNKTVGFITTDHSRIGTVQQLQDNVKTIGSEVIAVRDEAAMTRALTYFKEEARVDYILIDTAGKNYRTSETVEEMIETMGQVEPDYICLTLSASMKSKDMIEIITNFKDIHIDGIVFTKFDETASSGELLKIPAVSSAPIVLMTDGQDIRKNIHIATAEHLAKQMLQTS",
"proteome": null,
"gene": "BTCBT_001553",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006614",
"name": "SRP-dependent cotranslational protein targeting to membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0044781",
"name": "bacterial-type flagellum organization",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "38b8398da676471c4bc3b49201de8e9276d79f8b",
"counters": {
"domain_architectures": 10086,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"smart": 2,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 10086
}
}
}