General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAN4ADV8",
        "id": "A0AAN4ADV8_ECOLX",
        "source_organism": {
            "taxId": "869687",
            "scientificName": "Escherichia coli 4.0967",
            "fullName": "Escherichia coli 4.0967"
        },
        "name": "Potassium-transporting ATPase KdpC subunit",
        "description": [
            "Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex"
        ],
        "length": 190,
        "sequence": "MRGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFTGNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPDASTNVPVELVTASASGLDNNITPQAAVWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVELNLALDKLDE",
        "proteome": null,
        "gene": "kdpC",
        "go_terms": [
            {
                "identifier": "GO:0008556",
                "name": "P-type potassium transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006813",
                "name": "potassium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "37300587b18534ff9dc0f21fbf8387796c0f23f1",
        "counters": {
            "domain_architectures": 11798,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 11798
        }
    }
}