GET /api/protein/UniProt/A0AAN3ACN7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAN3ACN7",
"id": "A0AAN3ACN7_BACO1",
"source_organism": {
"taxId": "411476",
"scientificName": "Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153)",
"fullName": "Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153)"
},
"name": "Imidazole glycerol phosphate synthase subunit HisH",
"description": [
"IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF"
],
"length": 196,
"sequence": "MKVAVVKYNAGNIRSVDYALKRLGVEAVITADKEELQSADKVIFPGVGEAETTMNHLKATGLDELIKNLRQPVFGICLGMQLMCRHSEEGEVDCLNIFDVDVKRFVPQKHEDKVPHMGWNTIGKTNSKLFEGFTEEEFVYFVHSFYVPTCDFTAATTDYIHPFSAALHKDNFYATQFHPEKSGKTGEKILTNFLNL",
"proteome": null,
"gene": "hisH",
"go_terms": [
{
"identifier": "GO:0016763",
"name": "pentosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000105",
"name": "L-histidine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a79a81cdbd2eef5f5e295147e6f92925489d815d",
"counters": {
"domain_architectures": 82564,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 82564
}
}
}