General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAN1E3B5",
        "id": "A0AAN1E3B5_ECO57",
        "source_organism": {
            "taxId": "83334",
            "scientificName": "Escherichia coli O157:H7",
            "fullName": "Escherichia coli O157:H7"
        },
        "name": "Chaperone protein TorD",
        "description": [
            "Involved in the biogenesis of TorA. Acts on TorA before the insertion of the molybdenum cofactor and, as a result, probably favors a conformation of the apoenzyme that is competent for acquiring the cofactor"
        ],
        "length": 199,
        "sequence": "MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKSEPPLTAAVDELENRVATLTVRDDARLELAADFCGLFLMTDKQAALPYASAYKQDEQEIKRLLVEAGMETSGNFNEPTDHLAIYLELLSHLHFSLGEGTVPARRIDSLRQKTLTALRQWLPEFVARCHQYDSFGFYAALSQLLLVLVEGDHQNR",
        "proteome": null,
        "gene": "torD",
        "go_terms": [
            {
                "identifier": "GO:0051259",
                "name": "protein complex oligomerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a167cdf82ef9584e6d106088ccd950944c0d991",
        "counters": {
            "domain_architectures": 18629,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 18629
        }
    }
}