General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAN0YMV5",
        "id": "A0AAN0YMV5_PARTM",
        "source_organism": {
            "taxId": "1426",
            "scientificName": "Parageobacillus thermoglucosidasius",
            "fullName": "Parageobacillus thermoglucosidasius"
        },
        "name": "Quinol oxidase subunit 3",
        "description": [
            "Catalyzes quinol oxidation with the concomitant reduction of oxygen to water"
        ],
        "length": 204,
        "sequence": "MAEAAHRYDETMPLEYRTQESRLNILGFWIFLGAEVALFATLFATYLVLFQRTGSGPTAKELFEVKDVLIETLLLLTSSFTCGLAVFEMRRNRFSGLLTWLLVTLLLGAGFITFEIREFIHYVHEGATMQTSAFLSSFFVLVGTHGAHVSLGIGWMILIIIQILQRGLTPRTARKVFIVSLYWHFLDVVWIFIFTLVYLTGMVI",
        "proteome": "UP000093052",
        "gene": "BCV53_03365",
        "go_terms": [
            {
                "identifier": "GO:0004129",
                "name": "cytochrome-c oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0022904",
                "name": "respiratory electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042773",
                "name": "ATP synthesis coupled electron transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019646",
                "name": "aerobic electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "663ba42a1d577dd726fd8458ee1fa2f51292c5b5",
        "counters": {
            "domain_architectures": 68158,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 68158
        }
    }
}