General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAJ7UE98",
        "id": "A0AAJ7UE98_PETMA",
        "source_organism": {
            "taxId": "7757",
            "scientificName": "Petromyzon marinus",
            "fullName": "Petromyzon marinus (Sea lamprey)"
        },
        "name": "Electron transfer flavoprotein subunit beta",
        "description": [
            "Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases, including acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase. Required for normal mitochondrial fatty acid oxidation and normal amino acid metabolism. ETFB binds an AMP molecule that probably has a purely structural role",
            "The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase)"
        ],
        "length": 254,
        "sequence": "MALRVLVGVKRVIDYAVKIRVKPDKTGVVTDGVKHSMNPFCEIAMEEAVRLKEKKLAKEIVAVSCGPQQCQETIRTALAMGADRGIHVNVSGKEYEAMGPLQVSKILAALAKKEDVNLVILGKQAIDDDCNETGQMTAALLDWPQGTFASEIHLEGDKLKVVREIDGGLETIVINMPAVITADLRLNEPRYATLPNIMKAKKKKIDMVTPKDLGVDMASRVEILSVEDPPQRQAGIKVETTEQLVAKLREIGRI",
        "proteome": "UP001318040",
        "gene": "ETFB",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "14c4935a66043ac8637eba4ad4fb7f2339fc38d6",
        "counters": {
            "domain_architectures": 33962,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33962
        }
    }
}