General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAJ7GGI6",
        "id": "A0AAJ7GGI6_RHIBE",
        "source_organism": {
            "taxId": "61621",
            "scientificName": "Rhinopithecus bieti",
            "fullName": "Rhinopithecus bieti (Black snub-nosed monkey)"
        },
        "name": "tRNA methyltransferase 10 homolog B",
        "description": [
            "S-adenosyl-L-methionine-dependent guanine N(1)-methyltransferase that catalyzes the formation of N(1)-methylguanine at position 9 (m1G9) in tRNAs. Probably not able to catalyze formation of N(1)-methyladenine at position 9 (m1A9) in tRNAs"
        ],
        "length": 317,
        "sequence": "MDWRLEGSTQRVESPVLQGEEGVLEEETGEDGLPEGFQLLQIDAEGECQEGETLATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPGICPQHSKRFLRALTKEKLLEAKHSGPRLCIDLSMTHHMSKKELSRLAGQIRRLYGSNKKADRPFWICLTGFTIDSPLYEECVRMNDGFSSYLLDIKEEDCFSLFPLETLVYLTPDSEHALEDVDLNKVYILGGLVDESIQKKVTFQKAWEYSVKTARLPIQEYMVRNQNGKNYHSEILAINQVFDILSTYLETRNWPEALKKGVTSGKGYVLRNSVE",
        "proteome": "UP000233180",
        "gene": "TRMT10B",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a936c1e6c58a95144a0d8dc64f7693edd22205bc",
        "counters": {
            "domain_architectures": 7360,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7360
        }
    }
}