General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAJ6QX49",
        "id": "A0AAJ6QX49_9ACAR",
        "source_organism": {
            "taxId": "34638",
            "scientificName": "Galendromus occidentalis",
            "fullName": "Galendromus occidentalis (western predatory mite)"
        },
        "name": "KRR1 small subunit processome component homolog",
        "description": [
            "Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Binds to RNA. Required for female germline development, cell viability during eye development and for survival of dividing cells and epithelial cells during early wing disk development"
        ],
        "length": 280,
        "sequence": "MASGGESSKVPEDADPWKVPDFTKDDNPSGVVCESSFAMLFPKYREKYLKEVWPLVKKTLGEHGVEAELDVIEGSMIVKTTKQMWDPYIIIKARDLIKLLSRSVPFEQAARILEDDIACDIIKIGGMVRRKDRFVKRRQRLVGPNGATLKAMEILTDCYVLVQGNTVSTLGPYRGLKQVRKIVEDCMNNIHPIYHIKTMMIKRELAKDPELKDENWERFLPKLVNKNISKRKQPRVKRTKGEYNPFPPAPPKSKIDTELETGEYFLKEVDKRKRKRKEQA",
        "proteome": "UP000694867",
        "gene": "LOC100899994",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c28bbdb8e1998053365798208807311909ddd0fd",
        "counters": {
            "domain_architectures": 5243,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 2,
                "pfam": 2,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5243
        }
    }
}