GET /api/protein/UniProt/A0AAI9DXB2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAI9DXB2",
        "id": "A0AAI9DXB2_KLEOX",
        "source_organism": {
            "taxId": "571",
            "scientificName": "Klebsiella oxytoca",
            "fullName": "Klebsiella oxytoca"
        },
        "name": "Thiol:disulfide interchange protein",
        "description": [
            "Required for disulfide bond formation in some periplasmic proteins. Acts by transferring its disulfide bond to other proteins and is reduced in the process"
        ],
        "length": 252,
        "sequence": "MKYILLLAAWIMPGLASAGEALPQIVKNFGEQQGIAMIKEIDSPGGVKGWIGQYQDMGVTLFLTPDGKHVISGYLYDEKGKNLSEAYFQEAIYTPSGRKMWQTLNNARPLKEGADSAARKIIVFADPFCPWCKAFWSAAQPWVKAGKVQLNTLLVAFLNPKSGRYATAILNARDPAAAWREYELSGGKKVPHFEGVTPRDTFNLLQHHQKLMDDLGASATPAIYYMNEQNELQQVIGMPDEQQLREMFGPAP",
        "proteome": null,
        "gene": "dsbG",
        "go_terms": [
            {
                "identifier": "GO:0042597",
                "name": "periplasmic space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "411dc6ad206d244ac3dc75130cf3acae00785523",
        "counters": {
            "domain_architectures": 9553,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9553
        }
    }
}