GET /api/protein/UniProt/A0AAI8DGZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAI8DGZ5",
"id": "A0AAI8DGZ5_MAMSC",
"source_organism": {
"taxId": "1296",
"scientificName": "Mammaliicoccus sciuri",
"fullName": "Mammaliicoccus sciuri"
},
"name": "Acetolactate synthase small subunit",
"description": [
"Catalyzes the conversion of 2 pyruvate molecules into acetolactate in the first common step of the biosynthetic pathway of the branched-amino acids such as leucine, isoleucine, and valine"
],
"length": 157,
"sequence": "MKRTIKTQVLDRAGTLNRLTSIFVRRQYNIVSLSATPTETEGITNITFIVDVSDESSTETIIKQLEKQVNVISALDITDNNLFNRELILIKLGHPDDYQTFEKIIKPYEDQLTILKDLEDYIYIQAIGTHQTIENLLDDLKIYPVTQVSRTGSAGLL",
"proteome": null,
"gene": "ilvN",
"go_terms": [
{
"identifier": "GO:1990610",
"name": "acetolactate synthase regulator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009082",
"name": "branched-chain amino acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a9b4effdf535a8931dc57d1a1fda1d2ad19980d0",
"counters": {
"domain_architectures": 22562,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"profile": 1,
"pfam": 2,
"ncbifam": 1,
"panther": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 22562
}
}
}