GET /api/protein/UniProt/A0AAI8DGZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAI8DGZ5",
        "id": "A0AAI8DGZ5_MAMSC",
        "source_organism": {
            "taxId": "1296",
            "scientificName": "Mammaliicoccus sciuri",
            "fullName": "Mammaliicoccus sciuri"
        },
        "name": "Acetolactate synthase small subunit",
        "description": [
            "Catalyzes the conversion of 2 pyruvate molecules into acetolactate in the first common step of the biosynthetic pathway of the branched-amino acids such as leucine, isoleucine, and valine"
        ],
        "length": 157,
        "sequence": "MKRTIKTQVLDRAGTLNRLTSIFVRRQYNIVSLSATPTETEGITNITFIVDVSDESSTETIIKQLEKQVNVISALDITDNNLFNRELILIKLGHPDDYQTFEKIIKPYEDQLTILKDLEDYIYIQAIGTHQTIENLLDDLKIYPVTQVSRTGSAGLL",
        "proteome": null,
        "gene": "ilvN",
        "go_terms": [
            {
                "identifier": "GO:1990610",
                "name": "acetolactate synthase regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009082",
                "name": "branched-chain amino acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a9b4effdf535a8931dc57d1a1fda1d2ad19980d0",
        "counters": {
            "domain_architectures": 22562,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 2,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 22562
        }
    }
}