HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAI8BAF9",
"id": "A0AAI8BAF9_9BURK",
"source_organism": {
"taxId": "342113",
"scientificName": "Burkholderia oklahomensis",
"fullName": "Burkholderia oklahomensis"
},
"name": "Transcriptional activator protein IrlR",
"description": [
"Member of the two-component regulatory system IrlR/IrlS. May be involved in invasion of eukaryotic cells and heavy-metal resistance"
],
"length": 230,
"sequence": "MKVLIVEDELKTGMYLKRGLTEAGFVCDWTQDGISGLHQLQTENYDLAILDVMLPGCDGWTVVRELRRTHRTPVLFLTARDHVDDRVKGLELGGDDYLAKPFDFAELLARVRSLLRRGQATDAPVLRVANLELDLIQRKARRQGNTILLTAKEFLLLWLLMRRQGEILPRSLIASQIWDINFDSDSNVVDAAIKRVRAKVDQDYEPKLIHTVRGMGYVLEQRGESCESLA",
"proteome": "UP000029424",
"gene": "DM82_6289",
"go_terms": [
{
"identifier": "GO:0000160",
"name": "phosphorelay signal transduction system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000976",
"name": "transcription cis-regulatory region binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "214263e87a1ba73528c547c1c5657a9093191d60",
"counters": {
"domain_architectures": 293517,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"smart": 2,
"ssf": 1,
"profile": 2,
"cdd": 2,
"pfam": 2,
"panther": 1,
"ncbifam": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 293517
}
}
}