GET /api/protein/UniProt/A0AAG2TUK4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAG2TUK4",
"id": "A0AAG2TUK4_HUMAN",
"source_organism": {
"taxId": "9606",
"scientificName": "Homo sapiens",
"fullName": "Homo sapiens (Human)"
},
"name": "Beta-defensin-like domain-containing protein",
"description": [
"Has antimicrobial activity against E.coli. Plays a role in the defense response in the male reproductive tract, contributing to sperm maturation, storage and protection"
],
"length": 133,
"sequence": "MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGDVPPGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI",
"proteome": "UP000005640",
"gene": "SPAG11A",
"go_terms": [
{
"identifier": "GO:0006952",
"name": "defense response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c9fc0a7fc56173de24d607921b427f650f43150c",
"counters": {
"domain_architectures": 112,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 2,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 112
}
}
}