HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAE8JMQ1",
"id": "A0AAE8JMQ1_9GAMM",
"source_organism": {
"taxId": "1109412",
"scientificName": "Brenneria goodwinii",
"fullName": "Brenneria goodwinii"
},
"name": "Lipid A biosynthesis acyltransferase",
"description": [
"Catalyzes the transfer of an acyl chain from an acyl-[acyl-carrier-protein] (ACP) to a Kdo(2)-(acyl)-lipid IV(A) to form a Kdo(2)-lipid A"
],
"length": 323,
"sequence": "MEKEKKTSAEFVPQFKRAFYHPQYWGTWLGIGAIAIAAYIPARLRNPVLGGLGRLVGRFAKGARRRARINLLYCMPELTEEQRETIIDNMFATAPQAMVMMVDVGIRDPRKVEKHVCWHGEEILNKLKEQGRNVIFLVPHGWAVDIPAMLMTSRGQRMAAMFHNQKNELVDFWWNTLRRRFGGRIHARNDGIKPFISSVRQGCWGYYLPDQDHGAEHSEFVDFFATYKATLPAIGRLMKVCRAEIVPLFPVYNAKTCCLDVFIRPPMDDLTDADDQYIARRMNEEVEVLVRPNPEQYTWILKLLKTRKPGEIEPYCRDDLYRD",
"proteome": null,
"gene": "lpxM",
"go_terms": [
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016747",
"name": "acyltransferase activity, transferring groups other than amino-acyl groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009103",
"name": "lipopolysaccharide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009276",
"name": "Gram-negative-bacterium-type cell wall",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2fc14316fa184fd35cb4ef696ab680b7d1a370fd",
"counters": {
"domain_architectures": 31010,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ncbifam": 2,
"hamap": 1,
"pirsf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 31010
}
}
}