GET /api/protein/UniProt/A0AAE8JMQ1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAE8JMQ1",
        "id": "A0AAE8JMQ1_9GAMM",
        "source_organism": {
            "taxId": "1109412",
            "scientificName": "Brenneria goodwinii",
            "fullName": "Brenneria goodwinii"
        },
        "name": "Lipid A biosynthesis acyltransferase",
        "description": [
            "Catalyzes the transfer of an acyl chain from an acyl-[acyl-carrier-protein] (ACP) to a Kdo(2)-(acyl)-lipid IV(A) to form a Kdo(2)-lipid A"
        ],
        "length": 323,
        "sequence": "MEKEKKTSAEFVPQFKRAFYHPQYWGTWLGIGAIAIAAYIPARLRNPVLGGLGRLVGRFAKGARRRARINLLYCMPELTEEQRETIIDNMFATAPQAMVMMVDVGIRDPRKVEKHVCWHGEEILNKLKEQGRNVIFLVPHGWAVDIPAMLMTSRGQRMAAMFHNQKNELVDFWWNTLRRRFGGRIHARNDGIKPFISSVRQGCWGYYLPDQDHGAEHSEFVDFFATYKATLPAIGRLMKVCRAEIVPLFPVYNAKTCCLDVFIRPPMDDLTDADDQYIARRMNEEVEVLVRPNPEQYTWILKLLKTRKPGEIEPYCRDDLYRD",
        "proteome": null,
        "gene": "lpxM",
        "go_terms": [
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009103",
                "name": "lipopolysaccharide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009276",
                "name": "Gram-negative-bacterium-type cell wall",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2fc14316fa184fd35cb4ef696ab680b7d1a370fd",
        "counters": {
            "domain_architectures": 31010,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ncbifam": 2,
                "hamap": 1,
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 31010
        }
    }
}