GET /api/protein/UniProt/A0AAE6QKD4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAE6QKD4",
        "id": "A0AAE6QKD4_9PSED",
        "source_organism": {
            "taxId": "235275",
            "scientificName": "Pseudomonas coronafaciens pv. coronafaciens",
            "fullName": "Pseudomonas coronafaciens pv. coronafaciens"
        },
        "name": "tRNA sulfurtransferase",
        "description": [
            "Catalyzes the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor. Also catalyzes the transfer of sulfur to the sulfur carrier protein ThiS, forming ThiS-thiocarboxylate. This is a step in the synthesis of thiazole, in the thiamine biosynthesis pathway. The sulfur is donated as persulfide by IscS"
        ],
        "length": 484,
        "sequence": "MKLIVKVFPEITIKSPPVRKKFIRQLGKNIRTVLRELDADIVVGGVWDNLEVETRLTDPKVLQGIRDRLSCMPGIANYLQVAEYPLGDLDDIVAKCKLHYADLLPGKMFSVRCKRAGKHDFSSMDVEKYVGSKLRMQCGAAGIELKKPDLVVRMEIRDQRLFVVHDQHKGMGGYPLGALEQTLVLMSGGFDSTVAAYQIMRRGLMAHFCFFNLGGRAHELGVMEVAHFIWKKYGSSQRVLFVSVPFEEVLGEILQKVDNSHMGVVLKRMMLRAASAVADRLEIDVLVTGEAISQVASQTLPNLSLIDAATDKLVLRPLVATHKQDIVDLATEIGTADFARHMPEYCGVISVNPKTNAKRNRVEYEEKQFDMAILEQALERAKLVSIDRVIDDLSRNVDIEEVSQALAGQVIIDIRHPDAQEDQPLQVPGVEIQTLPFYALNSRFKALDDTRQYLLYCDKGVMSRLHAHHLLSEGHANVRVYRPS",
        "proteome": null,
        "gene": "thiI",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004810",
                "name": "CCA tRNA nucleotidyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016783",
                "name": "sulfurtransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0034227",
                "name": "tRNA thio-modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0052837",
                "name": "thiazole biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5de7818a69d05e8b17f84783bcbd66922037db3d",
        "counters": {
            "domain_architectures": 8689,
            "entries": 29,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 3,
                "cathgene3d": 3,
                "cdd": 2,
                "pfam": 3,
                "profile": 2,
                "smart": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "interpro": 11
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8689
        }
    }
}