HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAE6QKD4",
"id": "A0AAE6QKD4_9PSED",
"source_organism": {
"taxId": "235275",
"scientificName": "Pseudomonas coronafaciens pv. coronafaciens",
"fullName": "Pseudomonas coronafaciens pv. coronafaciens"
},
"name": "tRNA sulfurtransferase",
"description": [
"Catalyzes the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor. Also catalyzes the transfer of sulfur to the sulfur carrier protein ThiS, forming ThiS-thiocarboxylate. This is a step in the synthesis of thiazole, in the thiamine biosynthesis pathway. The sulfur is donated as persulfide by IscS"
],
"length": 484,
"sequence": "MKLIVKVFPEITIKSPPVRKKFIRQLGKNIRTVLRELDADIVVGGVWDNLEVETRLTDPKVLQGIRDRLSCMPGIANYLQVAEYPLGDLDDIVAKCKLHYADLLPGKMFSVRCKRAGKHDFSSMDVEKYVGSKLRMQCGAAGIELKKPDLVVRMEIRDQRLFVVHDQHKGMGGYPLGALEQTLVLMSGGFDSTVAAYQIMRRGLMAHFCFFNLGGRAHELGVMEVAHFIWKKYGSSQRVLFVSVPFEEVLGEILQKVDNSHMGVVLKRMMLRAASAVADRLEIDVLVTGEAISQVASQTLPNLSLIDAATDKLVLRPLVATHKQDIVDLATEIGTADFARHMPEYCGVISVNPKTNAKRNRVEYEEKQFDMAILEQALERAKLVSIDRVIDDLSRNVDIEEVSQALAGQVIIDIRHPDAQEDQPLQVPGVEIQTLPFYALNSRFKALDDTRQYLLYCDKGVMSRLHAHHLLSEGHANVRVYRPS",
"proteome": null,
"gene": "thiI",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004810",
"name": "CCA tRNA nucleotidyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016783",
"name": "sulfurtransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0034227",
"name": "tRNA thio-modification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0052837",
"name": "thiazole biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5de7818a69d05e8b17f84783bcbd66922037db3d",
"counters": {
"domain_architectures": 8689,
"entries": 29,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 3,
"cathgene3d": 3,
"cdd": 2,
"pfam": 3,
"profile": 2,
"smart": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"interpro": 11
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 8689
}
}
}