HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0AAD7QA47",
"id": "A0AAD7QA47_QUISA",
"source_organism": {
"taxId": "32244",
"scientificName": "Quillaja saponaria",
"fullName": "Quillaja saponaria (Soap bark tree)"
},
"name": "U6 snRNA-associated Sm-like protein LSm4",
"description": [
"Binds specifically to the 3'-terminal U-tract of U6 snRNA"
],
"length": 146,
"sequence": "MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRADRKPPGVGRGRGRGREDGPGGRQPKGIGRGLDDGGAKGAGGGRGRGGSGGNRGAGRGRG",
"proteome": "UP001163823",
"gene": "LSM4",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000398",
"name": "mRNA splicing, via spliceosome",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000956",
"name": "nuclear-transcribed mRNA catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006396",
"name": "RNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83b18cf71a575d59c0de6840812ffe7912383fc4",
"counters": {
"domain_architectures": 70645,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 70645
}
}
}